Lineage for d6bina2 (6bin A:82-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3049978Domain d6bina2: 6bin A:82-181 [350040]
    Other proteins in same PDB: d6bina1, d6bina3, d6binb1, d6binb2
    automated match to d1ieaa1
    complexed with nag

Details for d6bina2

PDB Entry: 6bin (more details), 2.5 Å

PDB Description: hla-drb1 in complex with type ii collagen peptide
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d6bina2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bina2 b.1.1.0 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d6bina2:

Click to download the PDB-style file with coordinates for d6bina2.
(The format of our PDB-style files is described here.)

Timeline for d6bina2:

  • d6bina2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07