SCOPe 2.08: Domain d6c09d2: 6c09 D:130-257

Lineage for d6c09d2 (6c09 D:130-257)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6c09d2: 6c09 D:130-257 [350032]
   Other proteins in same PDB: d6c09a1, d6c09b_, d6c09c2
   automated match to d3q5ya2
   complexed with d10, edo, ekg, k, nag, peg

Details for d6c09d2

PDB Entry: 6c09, 2.95 Å

PDB Description: ternary crystal structure of the 3c8 tcr-cd1c-monoacylglycerol complex

PDB Compounds: (D:) 3C8 T cell receptor beta-chain

SCOPe Domain Sequences for d6c09d2:

Sequence; same for both SEQRES and ATOM records:

>d6c09d2 b.1.1.0 (D:130-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6c09d2:

• d6c09d2 first appeared in SCOPe 2.07