Lineage for d6c09d1 (6c09 D:2-129)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3049969Domain d6c09d1: 6c09 D:2-129 [350031]
    Other proteins in same PDB: d6c09a1, d6c09b_, d6c09c2
    automated match to d3q5ya1
    complexed with d10, edo, ekg, k, nag, peg

Details for d6c09d1

PDB Entry: 6c09 (more details), 2.95 Å

PDB Description: ternary crystal structure of the 3c8 tcr-cd1c-monoacylglycerol complex
PDB Compounds: (D:) 3C8 T cell receptor beta-chain

SCOPe Domain Sequences for d6c09d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c09d1 b.1.1.0 (D:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglp
sdrfsaertggsvstltiqrtqqedsavylcasssyrgprmneqffgpgtrltvle

SCOPe Domain Coordinates for d6c09d1:

Click to download the PDB-style file with coordinates for d6c09d1.
(The format of our PDB-style files is described here.)

Timeline for d6c09d1:

  • d6c09d1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07