SCOPe 2.08: Domain d6c09c1: 6c09 C:2-128

Lineage for d6c09c1 (6c09 C:2-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6c09c1: 6c09 C:2-128 [350021]
   Other proteins in same PDB: d6c09a1, d6c09b_, d6c09c2
   automated match to d2f54d1
   complexed with d10, edo, ekg, k, nag, peg

Details for d6c09c1

PDB Entry: 6c09, 2.95 Å

PDB Description: ternary crystal structure of the 3c8 tcr-cd1c-monoacylglycerol complex

PDB Compounds: (C:) 3C8 T cell receptor alpha-chain

SCOPe Domain Sequences for d6c09c1:

Sequence; same for both SEQRES and ATOM records:

>d6c09c1 b.1.1.0 (C:2-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqvkqnspslsvqegrisilncdytnsmfdyflwykkypaegptflisissikdknedgr
ftvflnksakhlslhivpsqpgdsavyfcaasvgdkiifgkgtrlhilpn

Timeline for d6c09c1:

• d6c09c1 first appeared in SCOPe 2.07