SCOPe 2.08: Domain d6bv2a3: 6bv2 A:545-633

Lineage for d6bv2a3 (6bv2 A:545-633)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)

8. Domain d6bv2a3: 6bv2 A:545-633 [349986]
   Other proteins in same PDB: d6bv2a1, d6bv2a2, d6bv2a4, d6bv2a5
   automated match to d4fkea3
   complexed with ile, nag, so4, zn

Details for d6bv2a3

PDB Entry: 6bv2, 2.14 Å

PDB Description: crystal structure of porcine aminopeptidase-n with isoleucine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6bv2a3:

Sequence; same for both SEQRES and ATOM records:

>d6bv2a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

Timeline for d6bv2a3:

• d6bv2a3 first appeared in SCOPe 2.07