Lineage for d6b3ed2 (6b3e D:158-261)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2326968Protein automated matches [227027] (3 species)
    not a true protein
  7. 2326982Species Human (Homo sapiens) [TaxId:9606] [225840] (13 PDB entries)
  8. 3049865Domain d6b3ed2: 6b3e D:158-261 [349927]
    Other proteins in same PDB: d6b3ea_, d6b3ec_
    automated match to d2i53a2
    complexed with cjm, edo, mg

Details for d6b3ed2

PDB Entry: 6b3e (more details), 3.06 Å

PDB Description: crystal structure of human cdk12/cyclink in complex with an inhibitor
PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d6b3ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b3ed2 a.74.1.1 (D:158-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqg

SCOPe Domain Coordinates for d6b3ed2:

Click to download the PDB-style file with coordinates for d6b3ed2.
(The format of our PDB-style files is described here.)

Timeline for d6b3ed2:

  • d6b3ed2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07