Lineage for d6by0d2 (6by0 D:598-753)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859120Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 2859121Protein Catalase, C-terminal domain [52329] (2 species)
  7. 2859122Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries)
  8. 2859187Domain d6by0d2: 6by0 D:598-753 [349912]
    Other proteins in same PDB: d6by0a1, d6by0b1, d6by0c1, d6by0d1
    automated match to d1ggea1
    complexed with hem

Details for d6by0d2

PDB Entry: 6by0 (more details), 2.93 Å

PDB Description: crystal structure of catalase hpii from e. coli in space group p1
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d6by0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6by0d2 c.23.16.3 (D:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d6by0d2:

Click to download the PDB-style file with coordinates for d6by0d2.
(The format of our PDB-style files is described here.)

Timeline for d6by0d2: