Lineage for d6byfa1 (6byf A:116-281)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454573Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2454631Protein automated matches [190696] (5 species)
    not a true protein
  7. 3049766Species Saccharomyces cerevisiae [TaxId:559292] [349828] (1 PDB entry)
  8. 3049814Domain d6byfa1: 6byf A:116-281 [349876]
    Other proteins in same PDB: d6byfa2, d6byfb2, d6byfc2, d6byfd2, d6byfe2, d6byff2, d6byfg2, d6byfh2, d6byfi2
    automated match to d1xria_
    complexed with cit, cl, edo

Details for d6byfa1

PDB Entry: 6byf (more details), 2.35 Å

PDB Description: crystal structure of the core catalytic domain of pp-ip phosphatase siw14 from s. cerevisiae in complex with citrate
PDB Compounds: (A:) Tyrosine-protein phosphatase SIW14

SCOPe Domain Sequences for d6byfa1:

Sequence, based on SEQRES records: (download)

>d6byfa1 c.45.1.1 (A:116-281) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
vippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgikl
yqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnws
ltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw

Sequence, based on observed residues (ATOM records): (download)

>d6byfa1 c.45.1.1 (A:116-281) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
vippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgikl
yqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltmi
fdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw

SCOPe Domain Coordinates for d6byfa1:

Click to download the PDB-style file with coordinates for d6byfa1.
(The format of our PDB-style files is described here.)

Timeline for d6byfa1:

  • d6byfa1 is new in SCOPe 2.07-stable