Lineage for d6bnlg2 (6bnl G:118-206)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749745Domain d6bnlg2: 6bnl G:118-206 [349867]
    Other proteins in same PDB: d6bnla1, d6bnla2, d6bnlb_, d6bnlc1, d6bnld1, d6bnld2, d6bnle1, d6bnle2, d6bnlf_, d6bnlg1, d6bnlh1, d6bnlh2
    automated match to d4eura2
    complexed with nag, qwv

Details for d6bnlg2

PDB Entry: 6bnl (more details), 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule
PDB Compounds: (G:) NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains

SCOPe Domain Sequences for d6bnlg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnlg2 b.1.1.2 (G:118-206) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6bnlg2:

Click to download the PDB-style file with coordinates for d6bnlg2.
(The format of our PDB-style files is described here.)

Timeline for d6bnlg2: