Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [225108] (10 PDB entries) |
Domain d6bq6b_: 6bq6 B: [349865] automated match to d3o4fc_ complexed with cl, ter |
PDB Entry: 6bq6 (more details), 1.65 Å
SCOPe Domain Sequences for d6bq6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bq6b_ c.66.1.0 (B:) automated matches {Medicago truncatula [TaxId: 3880]} kscwyeeeieenlrwcfalnsilhtgasqyqdialldtkpfgkalvldgklqsaetdefi yheclvhpallhhpmpknvfimgggegstarellrhktidkvvmcdideevvefcksylv vnkeafhdsrlevvindakaelegkeekydvivgdladpieggpcyklytkdfyeltlkp klkkggifvtqagpagifshtevfsciyntlrqvfkyvvpysahipsyadiwgwvlasds pldlsaeeldirmrqriieenryldgktfvssstlskavrnslnnethvyte
Timeline for d6bq6b_: