Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
Domain d6byba2: 6byb A:314-421 [349858] automated match to d1oz2a3 complexed with ec7, edo, unx |
PDB Entry: 6byb (more details), 1.74 Å
SCOPe Domain Sequences for d6byba2:
Sequence, based on SEQRES records: (download)
>d6byba2 b.34.9.0 (A:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]} fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn
>d6byba2 b.34.9.0 (A:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]} fswsqylrstraqaapkhlfvsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflv hfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn
Timeline for d6byba2: