Lineage for d6br7b_ (6br7 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 3049712Species Acinetobacter sp. [TaxId:1310912] [349774] (1 PDB entry)
  8. 3049748Domain d6br7b_: 6br7 B: [349810]
    automated match to d2euba_
    complexed with bef, mg

Details for d6br7b_

PDB Entry: 6br7 (more details), 1.86 Å

PDB Description: beryllium fluorinated receiver domain of bfmr from acinetobacter baumannii
PDB Compounds: (B:) Two-component system response regulator protein

SCOPe Domain Sequences for d6br7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6br7b_ c.23.1.0 (B:) automated matches {Acinetobacter sp. [TaxId: 1310912]}
eeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpg
adgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallr
rtdkt

SCOPe Domain Coordinates for d6br7b_:

Click to download the PDB-style file with coordinates for d6br7b_.
(The format of our PDB-style files is described here.)

Timeline for d6br7b_:

  • d6br7b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07