SCOPe 2.07: Domain d6buya3: 6buy A:545-633

Lineage for d6buya3 (6buy A:545-633)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)

8. Domain d6buya3: 6buy A:545-633 [349806]
   Other proteins in same PDB: d6buya1, d6buya2, d6buya4, d6buya5
   automated match to d4fkea3
   complexed with gly, nag, so4, zn

Details for d6buya3

PDB Entry: 6buy, 2.1 Å

PDB Description: crystal structure of porcine aminopeptidase-n with glycine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6buya3:

Sequence; same for both SEQRES and ATOM records:

>d6buya3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

Timeline for d6buya3:

• d6buya3 is new in SCOPe 2.07-stable
  
• d6buya3 appears in the current release, SCOPe 2.08