SCOPe 2.08: Domain d6buya1: 6buy A:63-282

Lineage for d6buya1 (6buy A:63-282)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)

8. Domain d6buya1: 6buy A:63-282 [349804]
   Other proteins in same PDB: d6buya2, d6buya3, d6buya4, d6buya5
   automated match to d4fkea1
   complexed with gly, nag, so4, zn

Details for d6buya1

PDB Entry: 6buy, 2.1 Å

PDB Description: crystal structure of porcine aminopeptidase-n with glycine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6buya1:

Sequence; same for both SEQRES and ATOM records:

>d6buya1 b.98.1.0 (A:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

Timeline for d6buya1:

• d6buya1 first appeared in SCOPe 2.07