Lineage for d6br2b_ (6br2 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (74 PDB entries)
  8. 3049711Domain d6br2b_: 6br2 B: [349773]
    automated match to d5ufra_
    complexed with e3s, mpd

Details for d6br2b_

PDB Entry: 6br2 (more details), 3.18 Å

PDB Description: structure of rorgt in complex with a novel isoquinoline inverse agonist.
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6br2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6br2b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslc

SCOPe Domain Coordinates for d6br2b_:

Click to download the PDB-style file with coordinates for d6br2b_.
(The format of our PDB-style files is described here.)

Timeline for d6br2b_:

  • d6br2b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07