Lineage for d6bsxa1 (6bsx A:2-169)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867227Protein GTP-binding protein RheB [142275] (2 species)
  7. 2867228Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
    Uniprot Q15382 3-169
  8. 2867231Domain d6bsxa1: 6bsx A:2-169 [349770]
    Other proteins in same PDB: d6bsxa2, d6bsxb2, d6bsxc2, d6bsxd2
    automated match to d3t5ga_
    complexed with act, e7s, edo, gdp, mg

Details for d6bsxa1

PDB Entry: 6bsx (more details), 1.65 Å

PDB Description: crystal structure of rheb in complex with compound 1 at 1.65a resolution
PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d6bsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bsxa1 c.37.1.8 (A:2-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

SCOPe Domain Coordinates for d6bsxa1:

Click to download the PDB-style file with coordinates for d6bsxa1.
(The format of our PDB-style files is described here.)

Timeline for d6bsxa1: