Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTP-binding protein RheB [142275] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries) Uniprot Q15382 3-169 |
Domain d6bsxa1: 6bsx A:2-169 [349770] Other proteins in same PDB: d6bsxa2, d6bsxb2, d6bsxc2, d6bsxd2 automated match to d3t5ga_ complexed with act, e7s, edo, gdp, mg |
PDB Entry: 6bsx (more details), 1.65 Å
SCOPe Domain Sequences for d6bsxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bsxa1 c.37.1.8 (A:2-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek
Timeline for d6bsxa1: