Lineage for d6bq4a_ (6bq4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894830Species Medicago truncatula [TaxId:3880] [225108] (10 PDB entries)
  8. 2894837Domain d6bq4a_: 6bq4 A: [349758]
    automated match to d3o4fc_
    complexed with adn, b3p, gol, mes

Details for d6bq4a_

PDB Entry: 6bq4 (more details), 1.89 Å

PDB Description: crystal structure of medicago truncatula thermospermine synthase (mttsps) in complex with adenosine
PDB Compounds: (A:) Thermospermine synthase ACAULIS protein

SCOPe Domain Sequences for d6bq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bq4a_ c.66.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
kscwyeeeieenlrwcfalnsilhtgasqyqdialldtkpfgkalvldgklqsaetdefi
yheclvhpallhhpmpknvfimgggegstarellrhktidkvvmcdideevvefcksylv
vnkeafhdsrlevvindakaelegkeekydvivgdladpieggpcyklytkdfyeltlkp
klkkggifvtqagpagifshtevfsciyntlrqvfkyvvpysahipsyadiwgwvlasds
pldlsaeeldirmrqriieenryldgktfvssstlskavrnslnnethvyte

SCOPe Domain Coordinates for d6bq4a_:

Click to download the PDB-style file with coordinates for d6bq4a_.
(The format of our PDB-style files is described here.)

Timeline for d6bq4a_: