Lineage for d5x2ja1 (5x2j A:1-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303043Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303322Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303323Protein automated matches [226859] (36 species)
    not a true protein
  7. 3049672Species Staphylococcus equorum [TaxId:246432] [349734] (1 PDB entry)
  8. 3049673Domain d5x2ja1: 5x2j A:1-90 [349735]
    Other proteins in same PDB: d5x2ja2
    automated match to d1xrea1
    complexed with mn

Details for d5x2ja1

PDB Entry: 5x2j (more details), 1.4 Å

PDB Description: crystal structure of a recombinant hybrid manganese superoxide dismutase from staphylococcus equorum and staphylococcus saprophyticus
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5x2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x2ja1 a.2.11.0 (A:1-90) automated matches {Staphylococcus equorum [TaxId: 246432]}
mafelpnlpygfralephidqqtmeihhdkhhntyvtklnaavegtdlesksieeivanl
dsvpeniqtavrnnggghlnhslfwelltp

SCOPe Domain Coordinates for d5x2ja1:

Click to download the PDB-style file with coordinates for d5x2ja1.
(The format of our PDB-style files is described here.)

Timeline for d5x2ja1:

  • d5x2ja1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5x2ja2