Lineage for d6b8ya1 (6b8y A:200-502)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544917Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 2544918Species Human (Homo sapiens) [TaxId:9606] [56145] (30 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 3049612Domain d6b8ya1: 6b8y A:200-502 [349674]
    Other proteins in same PDB: d6b8ya2
    automated match to d5e8xa_
    complexed with d0a

Details for d6b8ya1

PDB Entry: 6b8y (more details), 1.65 Å

PDB Description: tgf-beta receptor type 1 kinase domain (t204d) in complex with n-(3- fluoropyridin-4-yl)-2-[6-(trifluoromethyl)pyridin-2-yl]-7h-pyrrolo[2, 3-d]pyrimidin-4-amine
PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d6b8ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b8ya1 d.144.1.7 (A:200-502) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiardivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
gik

SCOPe Domain Coordinates for d6b8ya1:

Click to download the PDB-style file with coordinates for d6b8ya1.
(The format of our PDB-style files is described here.)

Timeline for d6b8ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b8ya2