Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries) |
Domain d6bjna1: 6bjn A:18-105 [349617] Other proteins in same PDB: d6bjna2, d6bjnb2 automated match to d1t2ma1 |
PDB Entry: 6bjn (more details), 2.43 Å
SCOPe Domain Sequences for d6bjna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bjna1 b.36.1.0 (A:18-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrs ikgktkvevakmiqevkgevtihynklq
Timeline for d6bjna1: