SCOPe 2.08: Domain d6bjna1: 6bjn A:18-105

Lineage for d6bjna1 (6bjn A:18-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d6bjna1: 6bjn A:18-105 [349617]
   Other proteins in same PDB: d6bjna2, d6bjnb2
   automated match to d1t2ma1

Details for d6bjna1

PDB Entry: 6bjn, 2.43 Å

PDB Description: pick1 pdz domain in complex with the class i pdz binding motif qsav

PDB Compounds: (A:) PRKCA-binding protein

SCOPe Domain Sequences for d6bjna1:

Sequence; same for both SEQRES and ATOM records:

>d6bjna1 b.36.1.0 (A:18-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrs
ikgktkvevakmiqevkgevtihynklq

Timeline for d6bjna1:

• d6bjna1 first appeared in SCOPe 2.07