Lineage for d6bdff_ (6bdf F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2552634Species Thermoplasma acidophilum [TaxId:2303] [56253] (6 PDB entries)
  8. 3049550Domain d6bdff_: 6bdf F: [349612]
    Other proteins in same PDB: d6bdf0_, d6bdfa_, d6bdfc_, d6bdfe_, d6bdfg_, d6bdfi_, d6bdfk_, d6bdfm_, d6bdfo_, d6bdfq_, d6bdfs_, d6bdfu_, d6bdfw_, d6bdfy_
    automated match to d1pmab_

Details for d6bdff_

PDB Entry: 6bdf (more details), 2.8 Å

PDB Description: 2.8 a resolution reconstruction of the thermoplasma acidophilum 20s proteasome using cryo-electron microscopy
PDB Compounds: (F:) Proteasome subunit beta

SCOPe Domain Sequences for d6bdff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bdff_ d.153.1.4 (F:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklgl

SCOPe Domain Coordinates for d6bdff_:

Click to download the PDB-style file with coordinates for d6bdff_.
(The format of our PDB-style files is described here.)

Timeline for d6bdff_:

  • d6bdff_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07