Lineage for d6bdfx_ (6bdf X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993227Species Thermoplasma acidophilum [TaxId:2303] [56253] (7 PDB entries)
  8. 2993254Domain d6bdfx_: 6bdf X: [349611]
    Other proteins in same PDB: d6bdf0_, d6bdfa_, d6bdfc_, d6bdfe_, d6bdfg_, d6bdfi_, d6bdfk_, d6bdfm_, d6bdfo_, d6bdfq_, d6bdfs_, d6bdfu_, d6bdfw_, d6bdfy_
    automated match to d1pmab_

Details for d6bdfx_

PDB Entry: 6bdf (more details), 2.8 Å

PDB Description: 2.8 a resolution reconstruction of the thermoplasma acidophilum 20s proteasome using cryo-electron microscopy
PDB Compounds: (X:) Proteasome subunit beta

SCOPe Domain Sequences for d6bdfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bdfx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklgl

SCOPe Domain Coordinates for d6bdfx_:

Click to download the PDB-style file with coordinates for d6bdfx_.
(The format of our PDB-style files is described here.)

Timeline for d6bdfx_: