Lineage for d6aznb_ (6azn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864314Species Rhizobium leguminosarum [TaxId:216596] [346484] (5 PDB entries)
  8. 2864324Domain d6aznb_: 6azn B: [349550]
    automated match to d3irva_
    complexed with edo, po4

Details for d6aznb_

PDB Entry: 6azn (more details), 1.75 Å

PDB Description: structural and biochemical characterization of a non-canonical biuret hydrolase (biuh) from the cyanuric acid catabolism pathway of rhizobium leguminasorum bv. viciae 3841
PDB Compounds: (B:) Putative amidase

SCOPe Domain Sequences for d6aznb_:

Sequence, based on SEQRES records: (download)

>d6aznb_ c.33.1.0 (B:) automated matches {Rhizobium leguminosarum [TaxId: 216596]}
etnrhfidadpypwpyngalrpdntaliiidmqtdfcgkggyvdhmgydlslvqapiepi
krvlaamrakgyhiihtreghrpdladlpankrwrsqrigagigdpgpcgriltrgepgw
diipelypiegetiidkpgkgsfcatdlelvlnqkrieniiltgittdvsvsttmreand
rgyecllledccgatdygnhlaaikmvkmqggvfgsvsnsaalvealp

Sequence, based on observed residues (ATOM records): (download)

>d6aznb_ c.33.1.0 (B:) automated matches {Rhizobium leguminosarum [TaxId: 216596]}
etnrhfidadpypwpyngalrpdntaliiidmqtdfcgkggyydlslvqapiepikrvla
amrakgyhiihtreghrpdladlpankrwrsqrigagigdpgpcgriltrgepgwdiipe
lypiegetiidkpgkgsfcatdlelvlnqkrieniiltgittdvsvsttmreandrgyec
llledccgatdygnhlaaikmvkmqggvfgsvsnsaalvealp

SCOPe Domain Coordinates for d6aznb_:

Click to download the PDB-style file with coordinates for d6aznb_.
(The format of our PDB-style files is described here.)

Timeline for d6aznb_: