Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein automated matches [195145] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries) |
Domain d6az2b_: 6az2 B: [349506] Other proteins in same PDB: d6az2a_, d6az2c_, d6az2d2, d6az2e1, d6az2e2, d6az2f1, d6az2f2 automated match to d2dzea_ |
PDB Entry: 6az2 (more details), 2.48 Å
SCOPe Domain Sequences for d6az2b_:
Sequence, based on SEQRES records: (download)
>d6az2b_ b.1.22.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee lrenppakvqvdhivrnilaekprvtrfnivwd
>d6az2b_ b.1.22.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgdqeldsilvgpvpvg vnkfvfsadppssvtvillscsydgrefvrvgyyvnneydeeelrenppakvqvdhivrn ilaekprvtrfnivwd
Timeline for d6az2b_: