Lineage for d6az2b_ (6az2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766678Protein automated matches [195145] (3 species)
    not a true protein
  7. 2766683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries)
  8. 2766690Domain d6az2b_: 6az2 B: [349506]
    Other proteins in same PDB: d6az2a_, d6az2c_, d6az2d2, d6az2e1, d6az2e2, d6az2f1, d6az2f2
    automated match to d2dzea_

Details for d6az2b_

PDB Entry: 6az2 (more details), 2.48 Å

PDB Description: crystal structure of asf1-fab 12e complex
PDB Compounds: (B:) histone chaperone asf1

SCOPe Domain Sequences for d6az2b_:

Sequence, based on SEQRES records: (download)

>d6az2b_ b.1.22.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

Sequence, based on observed residues (ATOM records): (download)

>d6az2b_ b.1.22.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgdqeldsilvgpvpvg
vnkfvfsadppssvtvillscsydgrefvrvgyyvnneydeeelrenppakvqvdhivrn
ilaekprvtrfnivwd

SCOPe Domain Coordinates for d6az2b_:

Click to download the PDB-style file with coordinates for d6az2b_.
(The format of our PDB-style files is described here.)

Timeline for d6az2b_: