SCOPe 2.08: Domain d5ysld2: 5ysl D:118-222

Lineage for d5ysld2 (5ysl D:118-222)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d5ysld2: 5ysl D:118-222 [349501]
Other proteins in same PDB: d5ysla_, d5yslb1, d5yslc_, d5ysld1, d5ysle_, d5yslf1, d5yslg_, d5yslh1
automated match to d1h3pl2

Details for d5ysld2

PDB Entry: 5ysl (more details), 2.5 Å

PDB Description: crystal structure of antibody 1h1 fab

PDB Compounds: (D:) 1H1 light chain

SCOPe Domain Sequences for d5ysld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysld2 b.1.1.2 (D:118-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivknfnrn

SCOPe Domain Coordinates for d5ysld2:

Click to download the PDB-style file with coordinates for d5ysld2.
(The format of our PDB-style files is described here.)

Timeline for d5ysld2: