SCOPe 2.08: Domain d5z38a_: 5z38 A:

Lineage for d5z38a_ (5z38 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
   the family sequences are very divergent

6. Protein automated matches [227049] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [349001] (1 PDB entry)

8. Domain d5z38a_: 5z38 A: [349452]
   Other proteins in same PDB: d5z38e1, d5z38e2, d5z38f1, d5z38f2, d5z38g1, d5z38g2, d5z38h_, d5z38i1, d5z38i2, d5z38j_, d5z38k1, d5z38k2, d5z38l_
   automated match to d1k3ea_
   protein/RNA complex

Details for d5z38a_

PDB Entry: 5z38, 2.29 Å

PDB Description: crystal structure of csra bound to cest

PDB Compounds: (A:) CesT protein

SCOPe Domain Sequences for d5z38a_:

Sequence; same for both SEQRES and ATOM records:

>d5z38a_ d.198.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfpt
dnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksm
enlylvlhnqgitlenehmkieeisssdnkhyya

Timeline for d5z38a_:

• d5z38a_ first appeared in SCOPe 2.07