SCOPe 2.08: Domain d6atlc1: 6atl C:1-35

Lineage for d6atlc1 (6atl C:1-35)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein automated matches [197331] (11 species)
   not a true protein

7. Species Tityus serrulatus [TaxId:6887] [349390] (1 PDB entry)

8. Domain d6atlc1: 6atl C:1-35 [349391]
   Other proteins in same PDB: d6atla2, d6atlc2
   automated match to d1tska_
   complexed with cit, so4

Details for d6atlc1

PDB Entry: 6atl, 1.8 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox

PDB Compounds: (C:) Potassium channel toxin alpha-KTx 4.2

SCOPe Domain Sequences for d6atlc1:

Sequence; same for both SEQRES and ATOM records:

>d6atlc1 g.3.7.2 (C:1-35) automated matches {Tityus serrulatus [TaxId: 6887]}
vvigqrcyrspdcysackklvgkatgkctngrcdc

Timeline for d6atlc1:

• d6atlc1 first appeared in SCOPe 2.07