Lineage for d1dh0a_ (1dh0 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126906Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 126907Superfamily c.72.1: Ribokinase-like [53613] (3 families) (S)
  5. 126908Family c.72.1.1: Ribokinase-like [53614] (2 proteins)
  6. 126909Protein Adenosine kinase [53617] (2 species)
  7. 126912Species Toxoplasma gondii [TaxId:5811] [53619] (5 PDB entries)
  8. 126916Domain d1dh0a_: 1dh0 A: [34939]

Details for d1dh0a_

PDB Entry: 1dh0 (more details), 2.55 Å

PDB Description: structure of t. gondii adenosine kinase bound to adenosine

SCOP Domain Sequences for d1dh0a_:

Sequence, based on SEQRES records: (download)

>d1dh0a_ c.72.1.1 (A:) Adenosine kinase {Toxoplasma gondii}
gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaekvalsvanke
havevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaeki
vdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsf

Sequence, based on observed residues (ATOM records): (download)

>d1dh0a_ c.72.1.1 (A:) Adenosine kinase {Toxoplasma gondii}
gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaekvalsvanke
havtgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggfl
yglsqgktvkqcimcgnacaqdviqhvgfslsf

SCOP Domain Coordinates for d1dh0a_:

Click to download the PDB-style file with coordinates for d1dh0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dh0a_: