Lineage for d6b30a_ (6b30 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (74 PDB entries)
  8. 3049318Domain d6b30a_: 6b30 A: [349380]
    automated match to d5ufra_
    complexed with cfg

Details for d6b30a_

PDB Entry: 6b30 (more details), 2.69 Å

PDB Description: structure of rorgt in complex with a novel inverse agonist 1
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6b30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b30a_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqh

SCOPe Domain Coordinates for d6b30a_:

Click to download the PDB-style file with coordinates for d6b30a_.
(The format of our PDB-style files is described here.)

Timeline for d6b30a_:

  • d6b30a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07