SCOPe 2.08: Domain d6az2e2: 6az2 E:110-212

Lineage for d6az2e2 (6az2 E:110-212)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6az2e2: 6az2 E:110-212 [349374]
Other proteins in same PDB: d6az2a_, d6az2b_, d6az2c_, d6az2d1, d6az2d2, d6az2e1, d6az2f1
automated match to d4jg1l2

Details for d6az2e2

PDB Entry: 6az2 (more details), 2.48 Å

PDB Description: crystal structure of asf1-fab 12e complex

PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d6az2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6az2e2 b.1.1.2 (E:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOPe Domain Coordinates for d6az2e2:

Click to download the PDB-style file with coordinates for d6az2e2.
(The format of our PDB-style files is described here.)

Timeline for d6az2e2: