Lineage for d5z0ua1 (5z0u A:1-122)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (62 species)
    not a true protein
  7. 2363074Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)
  8. 3049296Domain d5z0ua1: 5z0u A:1-122 [349358]
    Other proteins in same PDB: d5z0ua2, d5z0ua3
    automated match to d1uh4a1
    complexed with ca, mpd; mutant

Details for d5z0ua1

PDB Entry: 5z0u (more details), 1.37 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) 11 residues (from a363 to n373) deletion mutant (del11)
PDB Compounds: (A:) Neopullulanase 1

SCOPe Domain Sequences for d5z0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0ua1 b.1.18.0 (A:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOPe Domain Coordinates for d5z0ua1:

Click to download the PDB-style file with coordinates for d5z0ua1.
(The format of our PDB-style files is described here.)

Timeline for d5z0ua1:

  • d5z0ua1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07