SCOPe 2.08: Domain d5z0tb1: 5z0t B:1-122

Lineage for d5z0tb1 (5z0t B:1-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)

8. Domain d5z0tb1: 5z0t B:1-122 [349349]
   Other proteins in same PDB: d5z0ta2, d5z0ta3, d5z0tb2, d5z0tb3
   automated match to d1uh4a1
   complexed with ca, mpd; mutant

Details for d5z0tb1

PDB Entry: 5z0t, 1.5 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) mutant a357v/q359n/y360e (aqy/vne)

PDB Compounds: (B:) Neopullulanase 1

SCOPe Domain Sequences for d5z0tb1:

Sequence; same for both SEQRES and ATOM records:

>d5z0tb1 b.1.18.0 (B:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

Timeline for d5z0tb1:

• d5z0tb1 first appeared in SCOPe 2.07