Lineage for d6atuk_ (6atu K:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031968Superfamily g.3.14: Elafin-like [57256] (2 families) (S)
    automatically mapped to Pfam PF00095
  5. 3031969Family g.3.14.1: Elafin-like [57257] (3 proteins)
  6. 3031977Protein automated matches [349139] (1 species)
    not a true protein
  7. 3031978Species Human (Homo sapiens) [TaxId:9606] [349140] (1 PDB entry)
  8. 3031989Domain d6atuk_: 6atu K: [349332]
    automated match to d2rela_

Details for d6atuk_

PDB Entry: 6atu (more details), 2.4 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox
PDB Compounds: (K:) elafin

SCOPe Domain Sequences for d6atuk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6atuk_ g.3.14.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkpgscpiilircamlnppnrclkdtdcpgikkccegscgmacfvpq

SCOPe Domain Coordinates for d6atuk_:

Click to download the PDB-style file with coordinates for d6atuk_.
(The format of our PDB-style files is described here.)

Timeline for d6atuk_: