Lineage for d6ayub1 (6ayu B:1-306)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015828Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 3015829Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 3016353Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 3016354Protein automated matches [190647] (18 species)
    not a true protein
  7. 3016419Species Mycobacterium tuberculosis [TaxId:419947] [349290] (1 PDB entry)
  8. 3016421Domain d6ayub1: 6ayu B:1-306 [349291]
    Other proteins in same PDB: d6ayua2, d6ayub2
    automated match to d3biga_
    complexed with f6p, gol, mg, mli

Details for d6ayub1

PDB Entry: 6ayu (more details), 2.2 Å

PDB Description: crystal structure of fructose-1,6-bisphosphatase t84s from mycobacterium tuberculosis
PDB Compounds: (B:) Fructose-1,6-bisphosphatase class 2

SCOPe Domain Sequences for d6ayub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ayub1 e.7.1.0 (B:1-306) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
melvrvteagamaagrwvgrgdkeggdgaavdamrelvnsvsmrgvvvigegekdhapml
yngeevgngdgpecdfavdpidgstlmskgmtnaisvlavadrgtmfdpsavfymnkiav
gpdaahvlditapiseniravakvkdlsvrdmtvcildrprhaqlihdvratgarirlit
dgdvagaisacrphsgtdllagiggtpegiiaaaaircmggaiqaqlaprddaerrkale
agydlnqvlttedlvsgenvffcatgvtdgdllkgvryypggctthsivmrsksgtvrmi
eayhrl

SCOPe Domain Coordinates for d6ayub1:

Click to download the PDB-style file with coordinates for d6ayub1.
(The format of our PDB-style files is described here.)

Timeline for d6ayub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ayub2