Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (6 proteins) |
Protein CREB-binding protein, CBP [74712] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74713] (37 PDB entries) |
Domain d6axqa_: 6axq A: [349270] Other proteins in same PDB: d6axqd2 automated match to d5i86a_ complexed with c2y, dms |
PDB Entry: 6axq (more details), 1.3 Å
SCOPe Domain Sequences for d6axqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6axqa_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
Timeline for d6axqa_:
View in 3D Domains from other chains: (mouse over for more information) d6axqb_, d6axqc_, d6axqd1, d6axqd2 |