Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Escherichia coli [TaxId:83333] [349042] (4 PDB entries) |
Domain d5z2lg1: 5z2l G:2-237 [349263] Other proteins in same PDB: d5z2la2, d5z2lb2, d5z2lc2, d5z2ld2, d5z2le2, d5z2lf2, d5z2lg2, d5z2lh2, d5z2li2, d5z2lj2, d5z2lk2, d5z2ll2 automated match to d4rlhb_ complexed with edo, gol, ndp, peg, pg0, pg4 |
PDB Entry: 5z2l (more details), 1.7 Å
SCOPe Domain Sequences for d5z2lg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z2lg1 c.2.1.0 (G:2-237) automated matches {Escherichia coli [TaxId: 83333]} gaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftdsa drdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaarqm peggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgpidt danpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhtidgafga
Timeline for d5z2lg1: