SCOPe 2.08: Domain d6avca1: 6avc A:3-38

Lineage for d6avca1 (6avc A:3-38)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.0: automated matches [335175] (1 protein)
   not a true family

6. Protein automated matches [335176] (4 species)
   not a true protein

7. Species Mesobuthus martensii [TaxId:34649] [349247] (1 PDB entry)

8. Domain d6avca1: 6avc A:3-38 [349248]
   Other proteins in same PDB: d6avca2
   automated match to d1c56a_

Details for d6avca1

PDB Entry: 6avc, 1.88 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox

PDB Compounds: (A:) Potassium channel toxin alpha-KTx 1.5

SCOPe Domain Sequences for d6avca1:

Sequence; same for both SEQRES and ATOM records:

>d6avca1 g.3.7.0 (A:3-38) automated matches {Mesobuthus martensii [TaxId: 34649]}
qftdvkctgskqcwpvckqmfgkpngkcmngkcrcy

Timeline for d6avca1:

• d6avca1 first appeared in SCOPe 2.07