Lineage for d5z81b_ (5z81 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956941Family d.66.1.3: Heat shock protein 15 kD [55182] (2 proteins)
    there are additional C-terminal structures
  6. 2956947Protein automated matches [349106] (1 species)
    not a true protein
  7. 2956948Species Vibrio cholerae [TaxId:345073] [349107] (1 PDB entry)
  8. 2956950Domain d5z81b_: 5z81 B: [349238]
    automated match to d1dm9b_
    complexed with mpd, so4

Details for d5z81b_

PDB Entry: 5z81 (more details), 2.33 Å

PDB Description: trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution
PDB Compounds: (B:) Heat Shock Protein 15

SCOPe Domain Sequences for d5z81b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z81b_ d.66.1.3 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
eevrldkwlwaarfyktrslarnmveggkvhyngqrakpsksveigaqitlrqghdekti
iiekisdqrrgapeaqqlyretaksitkrernammrqln

SCOPe Domain Coordinates for d5z81b_:

Click to download the PDB-style file with coordinates for d5z81b_.
(The format of our PDB-style files is described here.)

Timeline for d5z81b_: