Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.3: Heat shock protein 15 kD [55182] (2 proteins) there are additional C-terminal structures |
Protein automated matches [349106] (1 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [349107] (1 PDB entry) |
Domain d5z81b_: 5z81 B: [349238] automated match to d1dm9b_ complexed with mpd, so4 |
PDB Entry: 5z81 (more details), 2.33 Å
SCOPe Domain Sequences for d5z81b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z81b_ d.66.1.3 (B:) automated matches {Vibrio cholerae [TaxId: 345073]} eevrldkwlwaarfyktrslarnmveggkvhyngqrakpsksveigaqitlrqghdekti iiekisdqrrgapeaqqlyretaksitkrernammrqln
Timeline for d5z81b_: