Lineage for d5xmhc_ (5xmh C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757452Domain d5xmhc_: 5xmh C: [349179]
    Other proteins in same PDB: d5xmha1, d5xmha2, d5xmhb1, d5xmhb2, d5xmhl2
    automated match to d1igml_

Details for d5xmhc_

PDB Entry: 5xmh (more details), 2.8 Å

PDB Description: crystal structure of an igm rheumatoid factor yes8c in complex with igg1 fc
PDB Compounds: (C:) YES8c light chain

SCOPe Domain Sequences for d5xmhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmhc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsisssylawyqqrpgqaprlliygastratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspytfgqgtklei

SCOPe Domain Coordinates for d5xmhc_:

Click to download the PDB-style file with coordinates for d5xmhc_.
(The format of our PDB-style files is described here.)

Timeline for d5xmhc_: