Lineage for d5yoqb3 (5yoq B:389-569)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2336649Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2336650Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2336651Species Human (Homo sapiens) [TaxId:9606] [48555] (82 PDB entries)
    Uniprot P02768 29-596
  8. 3049111Domain d5yoqb3: 5yoq B:389-569 [349173]
    automated match to d1n5ua3
    complexed with clt, po4

Details for d5yoqb3

PDB Entry: 5yoq (more details), 2.65 Å

PDB Description: human serum albumin complexed with sodium 4-phenylbutyrate
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5yoqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoqb3 a.126.1.1 (B:389-569) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
a

SCOPe Domain Coordinates for d5yoqb3:

Click to download the PDB-style file with coordinates for d5yoqb3.
(The format of our PDB-style files is described here.)

Timeline for d5yoqb3:

  • d5yoqb3 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07