Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.14: Elafin-like [57256] (2 families) automatically mapped to Pfam PF00095 |
Family g.3.14.1: Elafin-like [57257] (3 proteins) |
Protein automated matches [349139] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [349140] (1 PDB entry) |
Domain d6atuf_: 6atu F: [349156] automated match to d2rela_ |
PDB Entry: 6atu (more details), 2.4 Å
SCOPe Domain Sequences for d6atuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6atuf_ g.3.14.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvstkpgscpiilircamlnppnrclkdtdcpgikkccegscgmacfvpq
Timeline for d6atuf_: