SCOPe 2.08: Domain d5x1ob_: 5x1o B:

Lineage for d5x1ob_ (5x1o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Basic FGF (FGF2) [50355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries)

8. Domain d5x1ob_: 5x1o B: [349124]
   automated match to d2fgfa_
   complexed with i3p

Details for d5x1ob_

PDB Entry: 5x1o, 1.9 Å

PDB Description: pi(4,5)p2 lipid binding induced a reorientation of fgf2 molecules near membrane surface to facilitate the unconventional oligomerization- dependent secretion process as revealed by a combined ftir/nmr/x-ray study

PDB Compounds: (B:) fibroblast growth factor 2

SCOPe Domain Sequences for d5x1ob_:

Sequence; same for both SEQRES and ATOM records:

>d5x1ob_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
kdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamk
edgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkai
lflpmsa

Timeline for d5x1ob_:

• d5x1ob_ first appeared in SCOPe 2.07