Lineage for d5yj6a_ (5yj6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330042Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2330137Protein automated matches [196672] (4 species)
    not a true protein
  7. 3049011Species Ruminiclostridium thermocellum [TaxId:637887] [349073] (1 PDB entry)
  8. 3049012Domain d5yj6a_: 5yj6 A: [349074]
    automated match to d1l1ya_
    complexed with 33o

Details for d5yj6a_

PDB Entry: 5yj6 (more details), 1.43 Å

PDB Description: the exoglucanase cels from clostridium thermocellum
PDB Compounds: (A:) Dockerin type I repeat-containing protein

SCOPe Domain Sequences for d5yj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yj6a_ a.102.1.2 (A:) automated matches {Ruminiclostridium thermocellum [TaxId: 637887]}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtqatfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyarqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tswgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaegaiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpd

SCOPe Domain Coordinates for d5yj6a_:

Click to download the PDB-style file with coordinates for d5yj6a_.
(The format of our PDB-style files is described here.)

Timeline for d5yj6a_:

  • d5yj6a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07