Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:272562] [349027] (1 PDB entry) |
Domain d5z7rc_: 5z7r C: [349046] automated match to d4fzwa_ |
PDB Entry: 5z7r (more details), 2.2 Å
SCOPe Domain Sequences for d5z7rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z7rc_ c.14.1.0 (C:) automated matches {Clostridium acetobutylicum [TaxId: 272562]} melnnvilekegkvavvtinrpkalnalnsdtlkemdyvigeiendsevlaviltgagek sfvagadisemkemntiegrkfgilgnkvfrrlellekpviaavngfalgggceiamscd iriassnarfgqpevglgitpgfggtqrlsrlvgmgmakqliftaqnikadealriglvn kvvepselmntakeiankivsnapvavklskqainrgmqcdidtalafeseafgecfste dqkdamtafiekrk
Timeline for d5z7rc_: