SCOPe 2.08: Domain d5z38g1: 5z38 G:1-37

Lineage for d5z38g1 (5z38 G:1-37)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.151: CsrA-like [117129] (1 superfamily)
   sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)

4. Superfamily b.151.1: CsrA-like [117130] (2 families)

5. Family b.151.1.1: CsrA-like [117131] (2 proteins)
   Pfam PF02599

6. Protein automated matches [190528] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:574521] [348991] (1 PDB entry)

8. Domain d5z38g1: 5z38 G:1-37 [348992]
   Other proteins in same PDB: d5z38a_, d5z38b_, d5z38c_, d5z38d_, d5z38e2, d5z38f2, d5z38g2, d5z38i2, d5z38k2
   automated match to d2jppa_
   protein/RNA complex

Details for d5z38g1

PDB Entry: 5z38, 2.29 Å

PDB Description: crystal structure of csra bound to cest

PDB Compounds: (G:) Truncated-CsrA

SCOPe Domain Sequences for d5z38g1:

Sequence; same for both SEQRES and ATOM records:

>d5z38g1 b.151.1.1 (G:1-37) automated matches {Escherichia coli [TaxId: 574521]}
mliltrrvgetlmigdevtvtvlgvkgnqvrigvnap

Timeline for d5z38g1:

• d5z38g1 first appeared in SCOPe 2.07