Lineage for d5yvma1 (5yvm A:1-400)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019289Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 3019290Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 3019359Family e.22.1.0: automated matches [191565] (1 protein)
    not a true family
  6. 3019360Protein automated matches [190982] (12 species)
    not a true protein
  7. 3019376Species Candidate divison [TaxId:1698264] [348971] (3 PDB entries)
  8. 3019378Domain d5yvma1: 5yvm A:1-400 [348980]
    Other proteins in same PDB: d5yvma2
    automated match to d3bfja_
    complexed with mn, nzq

Details for d5yvma1

PDB Entry: 5yvm (more details), 2.12 Å

PDB Description: crystal structure of the archaeal halo-thermophilic red sea brine pool alcohol dehydrogenase adh/d1 bound to nzq
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d5yvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvma1 e.22.1.0 (A:1-400) automated matches {Candidate divison [TaxId: 1698264]}
mefrhnlpssdiifgsgtlekigeetkkwgdkailvtgksnmkklgfladaidylesagv
etvhygeiepnptttvvdegaeivleegcdvvvalgggssmdaakgiamvaghsaeerdi
svwdfapegdketkpitektlpviaatstsgtgshvtpyavitnpetkgkpgfgnkhsfp
kvsivdidilkempprltaitgydvfshvsenltakgdhptadplairaieyvteyllra
vedgedikarekmavadtyaglsntisgttlrhamahpisgyypdishgqalasisvpim
ehniengdektwerysriavaldaskpvdntrqaaskavdglknllrsldldkplselgv
eeekipemtegafiymgggieanpvdvskedvkeifrksl

SCOPe Domain Coordinates for d5yvma1:

Click to download the PDB-style file with coordinates for d5yvma1.
(The format of our PDB-style files is described here.)

Timeline for d5yvma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvma2