SCOPe 2.08: Domain d5yvra1: 5yvr A:1-400

Lineage for d5yvra1 (5yvr A:1-400)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
   2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array

4. Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families)

5. Family e.22.1.0: automated matches [191565] (1 protein)
   not a true family

6. Protein automated matches [190982] (12 species)
   not a true protein

7. Species Candidate divison [TaxId:1698264] [348971] (3 PDB entries)

8. Domain d5yvra1: 5yvr A:1-400 [348972]
   Other proteins in same PDB: d5yvra2
   automated match to d3bfja_
   complexed with mn, ndp; mutant

Details for d5yvra1

PDB Entry: 5yvr, 1.9 Å

PDB Description: crystal structure of the h277a mutant of adh/d1, an archaeal halo- thermophilic red sea brine pool alcohol dehydrogenase

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d5yvra1:

Sequence; same for both SEQRES and ATOM records:

>d5yvra1 e.22.1.0 (A:1-400) automated matches {Candidate divison [TaxId: 1698264]}
mefrhnlpssdiifgsgtlekigeetkkwgdkailvtgksnmkklgfladaidylesagv
etvhygeiepnptttvvdegaeivleegcdvvvalgggssmdaakgiamvaghsaeerdi
svwdfapegdketkpitektlpviaatstsgtgshvtpyavitnpetkgkpgfgnkhsfp
kvsivdidilkempprltaitgydvfshvsenltakgdhptadplairaieyvteyllra
vedgedikarekmavadtyaglsntisgttlrhamaapisgyypdishgqalasisvpim
ehniengdektwerysriavaldaskpvdntrqaaskavdglknllrsldldkplselgv
eeekipemtegafiymgggieanpvdvskedvkeifrksl

Timeline for d5yvra1:

• d5yvra1 first appeared in SCOPe 2.07