Lineage for d5ypkf_ (5ypk F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (24 species)
    not a true protein
  7. 2556001Species Escherichia coli [TaxId:562] [226145] (15 PDB entries)
  8. 3048908Domain d5ypkf_: 5ypk F: [348970]
    automated match to d4eyba_
    complexed with cl, hiw, na, so4, zn

Details for d5ypkf_

PDB Entry: 5ypk (more details), 2 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed imipenem representing an ei2 complex
PDB Compounds: (F:) Metallo-beta-lactamase NDM-1

SCOPe Domain Sequences for d5ypkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ypkf_ d.157.1.0 (F:) automated matches {Escherichia coli [TaxId: 562]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5ypkf_:

Click to download the PDB-style file with coordinates for d5ypkf_.
(The format of our PDB-style files is described here.)

Timeline for d5ypkf_:

  • d5ypkf_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07