SCOPe 2.08: Domain d5yqwa_: 5yqw A:

Lineage for d5yqwa_ (5yqw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [348941] (10 PDB entries)

8. Domain d5yqwa_: 5yqw A: [348942]
   automated match to d4pfua_
   complexed with ni, p4g

Details for d5yqwa_

PDB Entry: 5yqw, 1.36 Å

PDB Description: structure and function of a novel periplasmic chitooligosaccharide- binding protein from marine vibrio bacteria

PDB Compounds: (A:) Peptide ABC transporter, periplasmic peptide-binding protein

SCOPe Domain Sequences for d5yqwa_:

Sequence; same for both SEQRES and ATOM records:

>d5yqwa_ c.94.1.0 (A:) automated matches {Vibrio harveyi [TaxId: 673519]}
aerseltihpkefttfvrnfnpflgatnlhtttdfiyeplvvfnemhgntpvfrlaenfq
msddlmsvtfdirkgvkwsdgeaftaddvvysfnlvkekpeldqsginswvtgvekvndy
qvkfrlseansnvpyeiakvpvvpkhvwskvkdpstftnenpvgsgpftvidtftpqlyi
qcenpnywdaanldvdclrvpqianndqflgkvvngemdwtssfvpdidrtyaaaspkhh
ywyppagtqafvvnfknpdaaknealtnvdfrrafsmaldrqtiidiafygggtvndfas
glgyafeawsdekthdkfkaynsynaegakkllakagfkdvnkdgfvdtpsgksfelliq
spngwtdfnntvqlaveqlaevgikarartpdfsvynqamlegtydvaytnyfhgadpyt
ywnsaynsalqsgdgmprfamhfyknekldgllnsfyktadkqeqleiahgiqqiiaqdq
vtipvlsgaymyqynttrftgwwneenpkgrpniwagiperllhvldlkpvk

Timeline for d5yqwa_:

• d5yqwa_ first appeared in SCOPe 2.07