Lineage for d5yqgb_ (5yqg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333757Species Mouse (Mus musculus) [TaxId:10090] [313882] (4 PDB entries)
  8. 3048840Domain d5yqgb_: 5yqg B: [348902]
    Other proteins in same PDB: d5yqga2, d5yqgc2
    automated match to d2npma_

Details for d5yqgb_

PDB Entry: 5yqg (more details), 2.1 Å

PDB Description: the structure of 14-3-3 and pnumb peptide
PDB Compounds: (B:) 14-3-3 protein eta

SCOPe Domain Sequences for d5yqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yqgb_ a.118.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrssw
rvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncndfqyesk
vfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlglalnfs
vfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d5yqgb_:

Click to download the PDB-style file with coordinates for d5yqgb_.
(The format of our PDB-style files is described here.)

Timeline for d5yqgb_:

  • d5yqgb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07